compare

Comparison List

SiriusGFP

SiriusGFP is a basic (constitutively fluorescent) green fluorescent protein published in 2018, derived from Aequorea victoria. It has moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 27.0 kDa -

FPbase ID: 4OC6N

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
504 516 56,600 0.214 12.11 5.29    
Edit States/Attributes

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
118.3 1.5 (mW) Laser Point Scanning Confocal Hela Zhong et al. (2018)
A caution on interpretation of photostability measurements
Add photostability info

SiriusGFP Sequence

BLAST

SiriusGFP was derived from EGFP with the following mutations: S30R/Y39N/F99S/N105T/S147R/M153T/V163A/S205V/A206K
amino acid numbers relative to avGFP. show relative to EGFP

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNRHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQVKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for SiriusGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Seeing the long tail: A novel green fluorescent protein, SiriusGFP, for ultra long timelapse imaging

Zhong S, Rivera-Molina F, Rivetta A, Toomre D, Santos-Sacchi J, Navaratnam D

(2018). Journal of Neuroscience Methods, , . doi: 10.1016/j.jneumeth.2018.12.008. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change