compare

Comparison List

shCP-T194I

shCP-T194I is a basic (constitutively fluorescent) fluorescent protein published in 2014.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? <add one> 25.6 kDa -

FPbase ID: DJL91

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
577            
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

shCP-T194I Sequence

BLAST

shCP-T194I was derived from shCP with the following mutations: T194I

MAGLLKESMRIKMDMEGTVNGHYFKCEGEGDGNPFTGTQSMRIHVTEGAPLPFAFDILAPCCEYGSRTFIHHTAGIPDFFKQSFPEGFTWERTTTYEDGGILTAHQDTSLEGNCLIYKVKVLGTNFPADGPVMKNKSEGWEPCTEVVYPDNGVLCGRNVMALKVGDRRLICHLYSSYKSKKAIRALTMPGFHFIDIRLQMPRKKKDEYFELYEASVARYSDLPEKAN

Excerpts

No excerpts have been added for shCP-T194I
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Different Visible Colors and Green Fluorescence Were Obtained from the Mutated Purple Chromoprotein Isolated from Sea Anemone

Chiang C-Y, Chen Y-L, Tsai H-J

(2014). Marine Biotechnology, 16(4) , 436-446. doi: 10.1007/s10126-014-9563-2. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change