compare

Comparison List

shCP

shCP is a basic (constitutively fluorescent) fluorescent protein published in 2014, derived from Stichodactyla haddoni. It is reported to be a dimer.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Stichodactyla haddoni 25.6 kDa -

FPbase ID: 23CA5

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
574            
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

shCP Sequence

BLAST
MAGLLKESMRIKMDMEGTVNGHYFKCEGEGDGNPFTGTQSMRIHVTEGAPLPFAFDILAPCCEYGSRTFIHHTAGIPDFFKQSFPEGFTWERTTTYEDGGILTAHQDTSLEGNCLIYKVKVLGTNFPADGPVMKNKSEGWEPCTEVVYPDNGVLCGRNVMALKVGDRRLICHLYSSYKSKKAIRALTMPGFHFTDIRLQMPRKKKDEYFELYEASVARYSDLPEKAN

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for shCP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Different Visible Colors and Green Fluorescence Were Obtained from the Mutated Purple Chromoprotein Isolated from Sea Anemone

Chiang C-Y, Chen Y-L, Tsai H-J

(2014). Marine Biotechnology, 16(4) , 436-446. doi: 10.1007/s10126-014-9563-2. Article   Pubmed

Additional References

  1. Crystal structure of the blue fluorescent protein with a Leu-Leu-Gly tri-peptide chromophore derived from the purple chromoprotein of Stichodactyla haddoni

    Chang H-Y, Ko T-P, Chang Y-C, Huang K-F, Lin C-Y, Chou H-Y, Chiang C-Y, Tsai H-J

    (2019). International Journal of Biological Macromolecules, 130, 675-684. doi: 10.1016/j.ijbiomac.2019.02.138. Article

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change