compare

Comparison List

shCP-E63L/Y64H

shCP-E63L/Y64H is a basic (constitutively fluorescent) blue fluorescent protein published in 2016.
+
shCP-E63L/Y64H Spectrum Fluorescent protein shCP-E63L/Y64H excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
? <add one> 25.5 kDa -

FPbase ID: ZOL96

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
403 451 1,276 0.17 0.22      

Photostability

No photostability measurements available ... add one!

shCP-E63L/Y64H Sequence

shCP-E63L/Y64H was derived from shCP with the following mutations: E63L/Y64H

MAGLLKESMRIKMDMEGTVNGHYFKCEGEGDGNPFTGTQSMRIHVTEGAPLPFAFDILAPCCLHGSRTFIHHTAGIPDFFKQSFPEGFTWERTTTYEDGGILTAHQDTSLEGNCLIYKVKVLGTNFPADGPVMKNKSEGWEPCTEVVYPDNGVLCGRNVMALKVGDRRLICHLYSSYKSKKAIRALTMPGFHFTDIRLQMPRKKKDEYFELYEASVARYSDLPEKAN

Excerpts

No excerpts have been added for shCP-E63L/Y64H
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change