compare

Comparison List

shCP-E63L/Y64H

shCP-E63L/Y64H is a basic (constitutively fluorescent) blue fluorescent protein published in 2016.
+
Oligomerization Organism Molecular Weight Cofactor
? <add one> 25.5 kDa -

FPbase ID: ZOL96

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
403 451 1,276 0.17 0.22      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

shCP-E63L/Y64H Sequence

BLAST

shCP-E63L/Y64H was derived from shCP with the following mutations: E63L/Y64H

MAGLLKESMRIKMDMEGTVNGHYFKCEGEGDGNPFTGTQSMRIHVTEGAPLPFAFDILAPCCLHGSRTFIHHTAGIPDFFKQSFPEGFTWERTTTYEDGGILTAHQDTSLEGNCLIYKVKVLGTNFPADGPVMKNKSEGWEPCTEVVYPDNGVLCGRNVMALKVGDRRLICHLYSSYKSKKAIRALTMPGFHFTDIRLQMPRKKKDEYFELYEASVARYSDLPEKAN

Excerpts

No excerpts have been added for shCP-E63L/Y64H
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Blue fluorescent protein derived from the mutated purple chromoprotein isolated from the sea anemone Stichodactyla haddoni

Chiang C-Y, Lin C-Y, Chen Y-T, Tsai H-J

(2016). Protein Engineering Design and Selection, 29(11) , 523-530. doi: 10.1093/protein/gzw041. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change