compare

Comparison List

ShadowY

ShadowY is a basic (constitutively fluorescent) yellow fluorescent protein published in 2017, derived from Aequorea victoria.
+
Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 26.9 kDa -

FPbase ID: D7L1L

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
519 531 136,000 0.01 1.36      

Photostability

No photostability measurements available ... add one!

ShadowY Sequence

ShadowY was derived from sREACh2 with the following mutations: K166S/R168Y
amino acid numbers relative to avGFP. show relative to sREACh2

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLICTTGKLPVPWPTLVTTFGYGLMCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYAWPVVNVYIMADKQKNGIKVNFSIYHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYSAKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for ShadowY
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

ShadowY: a dark yellow fluorescent protein for FLIM-based FRET measurement

Murakoshi H, Shibata Ace

(2017). Scientific Reports, 7(1) , 6791. doi: 10.1038/s41598-017-07002-4. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change