compare

Comparison List

sREACh2

sREACh2 is a basic (constitutively fluorescent) yellow fluorescent protein published in 2017, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 26.9 kDa -

FPbase ID: F9HKG

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
519 531 130,000 0.02 2.6      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

sREACh2 Sequence

BLAST

sREACh2 was derived from sREACh1 with the following mutations: Q204S/S205A
amino acid numbers relative to avGFP. show relative to sREACh1

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLICTTGKLPVPWPTLVTTFGYGLMCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYAWPVVNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYSAKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for sREACh2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

ShadowY: a dark yellow fluorescent protein for FLIM-based FRET measurement

Murakoshi H, Shibata Ace

(2017). Scientific Reports, 7(1) , 6791. doi: 10.1038/s41598-017-07002-4. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change