compare

Comparison List

ShadowG

ShadowG is a basic (constitutively fluorescent) green fluorescent protein published in 2015, derived from Aequorea victoria.
+
Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 27.0 kDa -

FPbase ID: JM7JP

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
486 510 89,000 0.005 0.45     0.16

Photostability

No photostability measurements available ... add one!

ShadowG Sequence

ShadowG was derived from sREACh with the following mutations: V148H/Y203T/A206K/R223F
amino acid numbers relative to avGFP. show relative to sREACh

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLICTTGKLPVPWPTLVTTFGYGLMCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNWNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for ShadowG
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change