compare

Comparison List

Nữ

a.k.a. super-REACh, improved non-radiative YFP

Nữ is a basic (constitutively fluorescent) yellow fluorescent protein published in 2008, derived from Aequorea victoria.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 27.0 kDa -

FPbase ID: UOJ8M

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
517 531 115,000 0.07 8.05      

Photostability

No photostability measurements available ... add one!

Nữ Sequence

Nữ was derived from REACh2 with the following mutations: F46L/Q69M/F223R
amino acid numbers relative to avGFP. show relative to REACh2

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLICTTGKLPVPWPTLVTTFGYGLMCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNWNSVNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLERVTAAGITLGMDELYK

Excerpts

No excerpts have been added for Nữ
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change