compare

Comparison List

SGFP2(T65G)

SGFP2(T65G) is a basic (constitutively fluorescent) green fluorescent protein published in 2007, derived from Aequorea victoria. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.9 kDa -

FPbase ID: BL164

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
501 512 90,000 0.35 31.5 6.7    

Photostability

No photostability measurements available ... add one!

SGFP2(T65G) Sequence

SGFP2(T65G) was derived from SGFP2 with the following mutations: T65G
amino acid numbers relative to avGFP. show relative to SGFP2

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for SGFP2(T65G)
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change