compare

Comparison List

scOrange

a.k.a. ScroogeOrange

scOrange is a basic (constitutively fluorescent) fluorescent protein published in 2018, derived from synthetic construct.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? synthetic construct 26.1 kDa -

FPbase ID: TVOBQ

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

scOrange Sequence

BLAST
MSKISDNVRIKLYMEGTVNNHHFMCEAEGEGKPYEGTQEMKIEVIEGGPLPFAFHILSTSCMYGSKTFIKYVSGIPDYFKQSFPEGFTWERTTTYEDGGFLTAHQDTSLDGDCLVYKVKILGNNFPADGPVMQNKAERWEPATEILYEVDGVLRGQTLMALKCADGNHLTCHLRTTYRSKKPASALKMPGFHFGDHRIEIMEEVEKGKCYKQYEAAVARYCDAAPSKLGHH

Excerpts

No excerpts have been added for scOrange
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Engineering a palette of eukaryotic chromoproteins for bacterial synthetic biology

Liljeruhm J, Funk Sk, Tietscher S, Edlund Ad, Jamal S, Wistrand-Yuen P, Dyrhage K, Gynnå A, Ivermark K, Lövgren J, Törnblom V, Virtanen A, Lundin Er, Wistrand-Yuen E, Forster Ac

(2018). Journal of Biological Engineering, 12(1) , . doi: 10.1186/s13036-018-0100-0. Article

Additional References

  1. Overcoming chromoprotein limitations by engineering a red fluorescent protein

    Bao L, Menon Pnk, Liljeruhm J, Forster Ac

    (2020). Analytical Biochemistry, 611, 113936. doi: 10.1016/j.ab.2020.113936. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change