compare

Comparison List

rsFolder2

rsFolder2 is a photoswitchable green fluorescent protein published in 2016, derived from Aequorea victoria. It has moderate acid sensitivity.
+
rsFolder2 Spectrum Fluorescent protein rsFolder2 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.9 kDa -

FPbase ID: 6VV9O

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 478 503 44,000 0.23 10.12 5.5    
Green (off)              

Transitions

From To Switch λ
Green (off) Green 405
Green Green (off) 488

Photostability

No photostability measurements available ... add one!

rsFolder2 Sequence

rsFolder2 was derived from rsFolder with the following mutations: F145Y
amino acid numbers relative to avGFP. show relative to rsFolder

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLAYGVLCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKSNFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for rsFolder2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change