compare

Comparison List

rsCherryRev

rsCherryRev is a photoswitchable red fluorescent protein published in 2008, derived from Discosoma sp..
+
rsCherryRev Spectrum Fluorescent protein rsCherryRev excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.7 kDa -

FPbase ID: 45EFN

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
On 572 608 84,000 0.005 0.42      
Off              

Transitions

From To Switch λ
Off On 450
On Off 550

Photostability

No photostability measurements available ... add one!

rsCherryRev Sequence

rsCherryRev was derived from mCherry with the following mutations: E144V/S146C/I161S/Q163M/V177F
amino acid numbers relative to DsRed. show relative to mCherry

MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWVACSERMYPEDGALKGESKMRLKLKDGGHYDAEFKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Excerpts

No excerpts have been added for rsCherryRev
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change