compare

Comparison List

rsCherry

rsCherry is a photoswitchable red fluorescent protein published in 2008, derived from Discosoma sp..

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.8 kDa -

FPbase ID: Q8AAM

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
On 572 610 80,000 0.02 1.6      
Off              
Edit States/Attributes

Transitions

From To Switch λ
On Off 450
Off On 550
Edit state transitions

Photostability

No photostability measurements available ... add one!

rsCherry Sequence

BLAST

rsCherry was derived from mCherry with the following mutations: E144V/I161S/V177F/K178W
amino acid numbers relative to DsRed. show relative to mCherry

MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWVASSERMYPEDGALKGESKQRLKLKDGGHYDAEFWTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK
GenBank: ACK57568
IPG: 16113845

Excerpts

No excerpts have been added for rsCherry
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Generation of Monomeric Reversibly Switchable Red Fluorescent Proteins for Far-Field Fluorescence Nanoscopy

Stiel Ac, Andresen M, Bock H, Hilbert M, Schilde J, Schönle A, Eggeling C, Egner A, Hell Sw, Jakobs S

(2008). Biophysical Journal, 95(6) , 2989-2997. doi: 10.1529/biophysj.108.130146. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change