compare

Comparison List

rsCherry

rsCherry is a multistate red fluorescent protein published in 2008, derived from Discosoma sp..

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.8 kDa -

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
On 572 610 80,000 0.02 1.6      
Off              

Transitions

From To Switch λ
On Off 450
Off On 550

Photostability

no photostability measurements available ... add one!

rsCherry Sequence

MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWVASSERMYPEDGALKGESKQRLKLKDGGHYDAEFWTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK
GenBank: ACK57568
IPG: 16113845

Excerpts

No excerpts have been added for rsCherry
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change