compare

Comparison List

roGFP1-R1

roGFP1-R1 is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2004, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 26.9 kDa -

FPbase ID: Y8A5R

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
400 508          
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

roGFP1-R1 Sequence

BLAST
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFISTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNCHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLKTCSALSKDPNEKRDHMVLLERVTAAGITHGMDELYK

Structure

Deposited: ,
Chromophore (SYG):

Excerpts

No excerpts have been added for roGFP1-R1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Investigating Mitochondrial Redox Potential with Redox-sensitive Green Fluorescent Protein Indicators

Hanson Gt, Aggeler R, Oglesbee D, Cannon M, Capaldi Ra, Tsien Ry, Remington Sj

(2004). Journal of Biological Chemistry, 279(13) , 13044-13053. doi: 10.1074/jbc.m312846200. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change