compare

Comparison List

RFP630

RFP630 is a basic (constitutively fluorescent) red fluorescent protein published in 2008, derived from Entacmaea quadricolor.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Tetramer Entacmaea quadricolor 26.0 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
583 630 50,000 0.35 17.5      

Photostability

no photostability measurements available ... add one!

RFP630 Sequence

RFP630 was derived from eqFP611 with the following mutations: N143S

MNSLIKENMRMMVVMEGSVNGYQFKCTGEGDGNPYMGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFIKHTKGIPDFFKQSFPEGFTWERVTRYEDGGVFTVMQDTSLEDGCLVYHAKVTGVNFPSNGAVMQKKTKGWEPSTEMLYPADGGLRGYSQMALNVDGGGYLSCSFETTYRSKKTVENFKMPGFHFVDHRLERLEESDKEMFVVQHEHAVAKFCDLPSKLGRL

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for RFP630
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change