compare

Comparison List

RFP611

RFP611 is a basic (constitutively fluorescent) red fluorescent protein published in 2008, derived from Entacmaea quadricolor.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Entacmaea quadricolor 26.0 kDa -

FPbase ID: 8DX6R

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
559 611 120,000 0.48 57.6   110.0  

Photostability

No photostability measurements available ... add one!

RFP611 Sequence

RFP611 was derived from eqFP611 with the following mutations: I57V/F102I

MNSLIKENMRMMVVMEGSVNGYQFKCTGEGDGNPYMGTQTMRIKVVEGGPLPFAFDVLATSFMYGSKTFIKHTKGIPDFFKQSFPEGFTWERVTRYEDGGVITVMQDTSLEDGCLVYHAKVTGVNFPSNGAVMQKKTKGWEPNTEMLYPADGGLRGYSQMALNVDGGGYLSCSFETTYRSKKTVENFKMPGFHFVDHRLERLEESDKEMFVVQHEHAVAKFCDLPSKLGRL

Excerpts

No excerpts have been added for RFP611
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change