compare

Comparison List

rfloGFP2

rfloGFP2 is a fluorescent protein published in 2008, derived from Ricordea florida.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Ricordea florida kDa -

FPbase ID: SAK3D

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

rfloGFP2 Sequence

MNALQEEMKIKLTMVGVVNGQSFKIDGKGKGKPYEGSQELTLKVVEGGPLLFSYDILTTIFQYGNRAFVNYPKDIPDIFKQTCSGLDGGYSWQRTMTYEDGGVCTATSNVSVVGDTFNYEIHFMGANFPPNGPVMQKRTVKWEPSTEIXFERDGLLRGDVPMSLLLKGGDHYRCDFKTIYKPNKKVKLPGYHFVDHCIEIKSQENDYNMVALFEDAVAHYSPLEKKSQAKA
GenBank: AAU06844
UniProtKB: Q66PW0
IPG: 3620744

Excerpts

No excerpts have been added for rfloGFP2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change