compare

Comparison List

RDSmCherry0.2

RDSmCherry0.2 is a basic (constitutively fluorescent) far red fluorescent protein published in 2017, derived from Discosoma sp..

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.6 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
600 630 34,400 0.03 1.03      

Photostability

no photostability measurements available ... add one!

RDSmCherry0.2 Sequence

RDSmCherry0.2 was derived from RDSmCherry0.1 with the following mutations: V195C/I197Y
amino acid numbers relative to DsRed. show relative to RDSmCherry0.1

MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEGKGRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNCNYKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Excerpts

No excerpts have been added for RDSmCherry0.2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change