compare

Comparison List

ppluGFP1

ppluGFP1 is a basic (constitutively fluorescent) green fluorescent protein published in 2004, derived from Pontellina plumata.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
? Pontellina plumata 24.6 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
480 500 65,000 0.6 39.0      

Photostability

no photostability measurements available ... add one!

ppluGFP1 Sequence

MPAMKIECRISGTLNGVVFELVGGGEGIPEQGRMTNKMKSTKGALTFSPYLLSHVMGYGFYHFGTYPSGYENPFLHAANNGGYTNTRIEKYEDGGVLHVSFSYRYEAGRVIGDFKVVGTGFPEDSVIFTDKIIRSNATVEHLHPMGDNVLVGSFARTFSLRDGGYYSFVVDSHMHFKSAIHPSILQNGGSMFAFRRVEELHSNTELGIVEYQHAFKTPTAFA
GenBank: AAQ01183
UniProtKB: Q6WV13
IPG: 1715606

Excerpts

No excerpts have been added for ppluGFP1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change