compare

Comparison List

ppluGFP1

ppluGFP1 is a basic (constitutively fluorescent) green fluorescent protein published in 2004, derived from Pontellina plumata.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Pontellina plumata 24.6 kDa -

FPbase ID: VPR4D

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
480 500 65,000 0.6 39.0      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

ppluGFP1 Sequence

BLAST
MPAMKIECRISGTLNGVVFELVGGGEGIPEQGRMTNKMKSTKGALTFSPYLLSHVMGYGFYHFGTYPSGYENPFLHAANNGGYTNTRIEKYEDGGVLHVSFSYRYEAGRVIGDFKVVGTGFPEDSVIFTDKIIRSNATVEHLHPMGDNVLVGSFARTFSLRDGGYYSFVVDSHMHFKSAIHPSILQNGGSMFAFRRVEELHSNTELGIVEYQHAFKTPTAFA
GenBank: AAQ01183
UniProtKB: Q6WV13
IPG: 1715606

Excerpts

No excerpts have been added for ppluGFP1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

GFP-like Proteins as Ubiquitous Metazoan Superfamily: Evolution of Functional Features and Structural Complexity

Shagin Da, Barsova Ev, Yanushevich Yg, Fradkov Af, Lukyanov Ka, Labas Ya, Semenova Tn, Ugalde Ja, Meyers A, Nunez Jm, Widder Ea, Lukyanov Sa, Matz Mv

(2004). Molecular Biology and Evolution, 21(5) , 841-850. doi: 10.1093/molbev/msh079. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change