compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

pHluorin4

This protein has unmoderated changes.

pHluorin4 is a basic (constitutively fluorescent) green fluorescent protein published in 2025, derived from Aequorea victoria. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization	Organism	Molecular Weight	Cofactor
?	Aequorea victoria	26.9 kDa	-

FPbase ID: 6E1ER

Attributes

State	Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
Acidic	488	520	15,900	0.85	13.52	6.7
Basic	405	520	20,800	0.63	13.1	6.71

Edit States/Attributes

Edit state transitions

Photostability

No photostability measurements available ... add one!

pHluorin4 Sequence

BLAST

pHluorin4 was derived from Superfolder GFP with the following mutations: T65S/E132D/S147E/N149L/N164I/K166Q/I167V/R168H/S202H/L220F T65S/E132D/S147E/N149L/N164I/K166Q/I167V/R168H/S202H/L220F

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKDDGNILGHKLEYNFNEHLVYITADKQKNGIKAIFQVHHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLHTQSVLSKDPNEKRDHMVFLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for pHluorin4
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

The <scp>pH</scp> ‐dependent photophysical and spectral properties of <scp>pH</scp> ‐sensing green fluorescent proteins

Thornell Im

(2025). Physiological Reports, 13(20) , e70625. doi: 10.14814/phy2.70625. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for pHluorin4
Search RIKEN BRC for pHluorin4

Change history

Something missing or incorrect? Submit a change Submit a change