compare

Comparison List

phiYFP

phiYFP is a basic (constitutively fluorescent) yellow fluorescent protein published in 2004, derived from Phialidium sp. SL-2003.
+
Oligomerization Organism Molecular Weight Cofactor
Dimer Phialidium sp. SL-2003 26.1 kDa -

FPbase ID: 7DEM9

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
525 537 115,000 0.6 69.0      

Photostability

No photostability measurements available ... add one!

phiYFP Sequence

MSSGALLFHGKIPYVVEMEGNVDGHTFSIRGKGYGDASVGKVDAQFICTTGDVPVPWSTLVTTLTYGAQCFAKYGPELKDFYKSCMPEGYVQERTITFEGDGVFKTRAEVTFENGSVYNRVKLNGQGFKKDGHVLGKNLEFNFTPHCLYIWGDQANHGLKSAFKIMHEITGSKEDFIVADHTQMNTPIGGGPVHVPEYHHITYHVTLSKDVTDHRDNMSLVETVRAVDCRKTYL
GenBank: AY485333

Excerpts

No excerpts have been added for phiYFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Photoswitchable cyan fluorescent protein as a FRET donor

    Souslova Ea, Chudakov Dm

    (2006). Microscopy Research and Technique, 69(3) , 207-209. doi: 10.1002/jemt.20278. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change