compare

Comparison List

pH-tdGFP

pH-tdGFP is a basic (constitutively fluorescent) green fluorescent protein published in 2016, derived from Aequorea victoria. It has low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tandem dimer Aequorea victoria 54.2 kDa -

FPbase ID: 9GPWY

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
488 515     4.8    
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

pH-tdGFP Sequence

BLAST

pH-tdGFP was derived from Superfolder GFP with the following mutations: N149Y/Q204H

MSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHYVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTHSVLSKDPNEKRDHMVLLEFVTAAGITHGHGTGSTGSGSSGTASSEDNNMALFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHYVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTHSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for pH-tdGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Identification and Characterisation of a pH-stable GFP

Roberts Tm, Rudolf F, Meyer A, Pellaux R, Whitehead E, Panke S, Held M

(2016). Scientific Reports, 6(1) , . doi: 10.1038/srep28166. Article

Additional References

  1. I see the light! Fluorescent proteins suitable for cell wall/apoplast targeting in Nicotiana benthamiana leaves

    Stoddard A, Rolland V

    (2019). Plant Direct, 3(1) , e00112. doi: 10.1002/pld3.112. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change