compare

Comparison List

pcDronpa

pcDronpa is a photoswitchable red fluorescent protein published in 2014, derived from Echinophyllia sp. SC22. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Tetramer Echinophyllia sp. SC22 25.4 kDa -

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Red 569 581 75,000 0.68 51.0 6.3   3.9
Green (Off)              
Green (On) 505 517 115,000 0.85 97.75 5.5   3.2

Transitions

From To Switch λ
Green (Off) Green (On) 405
Green (On) Red 405
Green (On) Green (Off) 488

Photostability

no photostability measurements available ... add one!

pcDronpa Sequence

pcDronpa was derived from ffDronpa with the following mutations: C62H/N94S/N102I/E218G

MSVIKPDMKIKLRMEGAVNGHPFAIEGVGLGKPFEGKQSMDLKVKEGGPLPFAYDILTTAFHYGNRVFAKYPENIVDYFKQSFPEGYSWERSMSYEDGGICIATNDITLDGDCYIYEIRFDGVNFPANGPVMQKRTVKWEPSTEKLYVRDGVLKGDVNMALSLEGGGHYRCDFKTTYKAKKVVQLPDYHFVDHHIEIKSHDKDYSNVNLHEHAEAHSGLPRQAK

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for pcDronpa
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change