compare

Comparison List

ffDronpa

a.k.a. Dronpa-V60A, fast-forming Dronpa

ffDronpa is a photoswitchable green fluorescent protein published in 2014, derived from Echinophyllia sp. SC22. It is reported to be a very rapidly-maturing monomer with low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Echinophyllia sp. SC22 25.5 kDa -

FPbase ID: 9U6KU

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
On 503 517 10,500 0.75 7.88 5.0 15.0  
Off              

Transitions

From To Switch λ
Off On 405
On Off 488

Photostability

No photostability measurements available ... add one!

ffDronpa Sequence

ffDronpa was derived from Dronpa with the following mutations: V60A

MSVIKPDMKIKLRMEGAVNGHPFAIEGVGLGKPFEGKQSMDLKVKEGGPLPFAYDILTTAFCYGNRVFAKYPENIVDYFKQSFPEGYSWERSMNYEDGGICNATNDITLDGDCYIYEIRFDGVNFPANGPVMQKRTVKWEPSTEKLYVRDGVLKGDVNMALSLEGGGHYRCDFKTTYKAKKVVQLPDYHFVDHHIEIKSHDKDYSNVNLHEHAEAHSELPRQAK

Excerpts

By observing the brightness of bacterial colonies expressing randomly mutated Dronpa genes, we identified Dronpa-V60A, a monomeric Dronpa mutant with increased in-colony brightness. In vitro maturation measurements showed that Dronpa-V60A forms almost three times faster than Dronpa, with a maturation half-time of less than 15 min. We thus called this mutant “fast-forming” or ffDronpa.

Moeyaert et al. (2014)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change