compare

Comparison List

PATagRFP1314

PATagRFP1314 is a photoactivatable red fluorescent protein published in 2010, derived from Entacmaea quadricolor. It is reported to be a rapidly-maturing dimer.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Entacmaea quadricolor 26.1 kDa -

FPbase ID: 7UFQR

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Off              
On 562 596 61,000 0.46 28.06   25.0  

Transitions

From To Switch λ
Off On 405

Photostability

State t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
On 83.0 Subach et al. (2010)

PATagRFP1314 Sequence

MSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSSTFINHTQGIPDFWKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMKKKTLGWEPSTEMLYPADGGLEGVVNMALKLVGGGHLICNFKTTYRSKKPAKNLKMPGVYYVDRRLEQIKEADKETYWEQHEVAVARYCDLPSKLGHK

Excerpts

No excerpts have been added for PATagRFP1314
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Something missing or incorrect? Submit a change Submit a change