compare

Comparison List

PATagRFP1297

PATagRFP1297 is a basic (constitutively fluorescent) red fluorescent protein published in 2010, derived from Entacmaea quadricolor. It is reported to be a rapidly-maturing tetramer.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Tetramer Entacmaea quadricolor 26.0 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
563 595 63,000 0.42 26.46   25.0  

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
81.0 Subach et al. (2010)

PATagRFP1297 Sequence

MSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSSTFINHTQGIPDFFKQSWPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMKKKTLGWEPSTEMLYPADGGLGGVVDMALKLVGGGHLICNFKTTYRSKKPAKNLKMPGVYYVDRRLEIIKEADKETYWEQHEVAVARYCDLPSKLGHK

Excerpts

No excerpts have been added for PATagRFP1297
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change