compare

Comparison List

PATagRFP1297

PATagRFP1297 is a photoactivatable red fluorescent protein published in 2010, derived from Entacmaea quadricolor. It is reported to be a rapidly-maturing tetramer.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Entacmaea quadricolor 26.0 kDa -

FPbase ID: XQCPX

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Off              
On 563 595 63,000 0.42 26.46   25.0  

Transitions

From To Switch λ
Off On 405

Photostability

State t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
On 81.0 Subach et al. (2010)

PATagRFP1297 Sequence

MSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSSTFINHTQGIPDFFKQSWPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMKKKTLGWEPSTEMLYPADGGLGGVVDMALKLVGGGHLICNFKTTYRSKKPAKNLKMPGVYYVDRRLEIIKEADKETYWEQHEVAVARYCDLPSKLGHK

Excerpts

No excerpts have been added for PATagRFP1297
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Something missing or incorrect? Submit a change Submit a change