compare

Comparison List

Padron2

Padron2 is a photoswitchable green fluorescent protein published in 2021, derived from Echinophyllia sp. SC22. It is reported to be a somewhat slowly-maturing monomer with high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Echinophyllia sp. SC22 25.2 kDa -

FPbase ID: DSZCH

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Off-state     48,700          
On-state 492 516 32,700 0.49 16.02 6.6 70.0 3.5
Edit States/Attributes
Edit state transitions

Photostability

No photostability measurements available ... add one!

Padron2 Sequence

BLAST

Padron2 was derived from Padron with the following mutations: S2A/M40V/T58S/R66K/A69I/S82L/Y114F/L141P/F173S/S190A/E218G/R221G/K224M

MAVIKPDMKIKLRMEGAVNGHPFAIEGVGLGKPFEGKQSVDLKVKEGGPLPFAYDILSMAFCYGNKVFIKYPENIVDYFKQLFPEGYSWERSMIYEDGGICNATNDITLDGDCFIYEIRFDGVNFPANGPVMQKRTVKWEPSTEKLYVRDGVLKSDGNYALSLEGGGHYRCDSKTTYKAKKVVQLPDYHAVDHHIEIKSHDKDYSNVNLHEHAEAHSGLPGQAM
GenBank: MZ404620.1

Excerpts

No excerpts have been added for Padron2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

The Positive Switching Fluorescent Protein Padron2 Enables Live-Cell Reversible Saturable Optical Linear Fluorescence Transitions (RESOLFT) Nanoscopy without Sequential Illumination Steps

Konen T, Stumpf D, Grotjohann T, Jansen I, Bossi M, Weber M, Jensen N, Hell Sw, Jakobs S

(2021). ACS Nano, 15(6) , 9509-9521. doi: 10.1021/acsnano.0c08207. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change