compare

Comparison List

Padron0.9

Padron0.9 is a photoswitchable green/yellow fluorescent protein published in 2010, derived from Echinophyllia sp. SC22.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Echinophyllia sp. SC22 25.4 kDa -

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
On 505 522 36,000 0.61 21.96      
Off              

Transitions

From To Switch λ
On Off 405
Off On 488

Photostability

no photostability measurements available ... add one!

Padron0.9 Sequence

Padron0.9 was derived from Padron with the following mutations: Y116C/K198I

MSVIKPDMKIKLRMEGAVNGHPFAIEGVGLGKPFEGKQSMDLKVKEGGPLPFAYDILTMAFCYGNRVFAKYPENIVDYFKQSFPEGYSWERSMIYEDGGICNATNDITLDGDCYICEIRFDGVNFPANGPVMQKRTVKWELSTEKLYVRDGVLKSDGNYALSLEGGGHYRCDFKTTYKAKKVVQLPDYHSVDHHIEIISHDKDYSNVNLHEHAEAHSELPRQAK

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for Padron0.9
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change