compare

Comparison List

P4-1

P4-1 is a basic (constitutively fluorescent) green fluorescent protein published in 1996, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 26.8 kDa -

FPbase ID: 9CEJ5

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
504 514 14,500 0.54 7.83      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

P4-1 Sequence

BLAST
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIAADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYE

Excerpts

No excerpts have been added for P4-1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Engineering green fluorescent protein for improved brightness, longer wavelengths and fluorescence resonance energy transfer

Heim R, Tsien Ry

(1996). Current Biology, 6(2) , 178-182. doi: 10.1016/s0960-9822(02)00450-5. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change