compare

Comparison List

P11

P11 is a basic (constitutively fluorescent) cyan fluorescent protein published in 1994, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 26.9 kDa -

FPbase ID: R9DP6

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
471 502          

Photostability

No photostability measurements available ... add one!

P11 Sequence

P11 was derived from avGFP with the following mutations: Q80R/I167T

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKTRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for P11
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Wavelength mutations and posttranslational autoxidation of green fluorescent protein.

Heim R, Prasher Dc, Tsien Ry

(1994). Proceedings of the National Academy of Sciences, 91(26) , 12501-12504. doi: 10.1073/pnas.91.26.12501. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change