compare

Comparison List

O-Velour

O-Velour is a basic (constitutively fluorescent) fluorescent protein published in 2022.
+
O-Velour Spectrum Fluorescent protein O-Velour excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
? <add one> 25.1 kDa -

FPbase ID: JS116

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
506   20,000 0.001 0.02      

Photostability

No photostability measurements available ... add one!

O-Velour Sequence

O-Velour was derived from R-Velour with the following mutations: M153A/S155G

MALFAKPMNHKTEITGEFNGKCFKVVGHGSAPGGGDFRMHAYCESGTLPVSWCVLSPSIQYGFSMFTKYPNGITNFFQEAFPEGYTLDRVMTRENGGSVVSHHSYDLGKDGITAKVSVKGEGFDPNGPTMTKGYLKVLPFVCHLYPHGAGVRATGSVGMVKTDGSLDIFNVDSNYQPVGSRKVSVPKFHFVQHRIILMKDKSDTRDHIVMREIAVAQDPNEAQSAFRIA

Excerpts

No excerpts have been added for O-Velour
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change