compare

Comparison List

mWatermelon

mWatermelon is a basic (constitutively fluorescent) green fluorescent protein published in 2023, derived from synthetic construct. It has moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer synthetic construct 26.3 kDa -

FPbase ID: V41RE

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
504 515 88,000 0.47 41.36 5.2    
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mWatermelon Sequence

BLAST

mWatermelon was derived from mScarlet-I with the following mutations: V8L/F12Y/N24D/Q43H/M67G/Y121H/K139R/F178C

MVSKGEALIKEYMRFKVHMEGSMDGHEFEIEGEGEGRPYEGTHTAKLKVTKGGPLPFSWDILSPQFGYGSRAFIKHPADIPDYYKQSFPEGFKWERVMNFEDGGAVTVTQDTSLEDGTLIHKVKLRGTNFPPDGPVMQRKTMGWEASTERLYPEDGVLKGDIKMALRLKDGGRYLADCKTTYKAKKPVQMPGAYNVDRKLDITSHNEDYTVVEQYERSEGRHSTGGMDELYK

Excerpts

No excerpts have been added for mWatermelon
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Biosensor Optimization Using a Förster Resonance Energy Transfer Pair Based on mScarlet Red Fluorescent Protein and an mScarlet-Derived Green Fluorescent Protein

Gohil K, Wu S-Y, Takahashi-Yamashiro K, Shen Y, Campbell Re

(2023). ACS Sensors, 8(2) , 587-597. doi: 10.1021/acssensors.2c01730. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change