compare

Comparison List

mWatermelon

mWatermelon is a basic (constitutively fluorescent) fluorescent protein published in 2023.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? <add one> 26.3 kDa -

FPbase ID: V41RE

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

mWatermelon Sequence

BLAST
MVSKGEALIKEYMRFKVHMEGSMDGHEFEIEGEGEGRPYEGTHTAKLKVTKGGPLPFSWDILSPQFGYGSRAFIKHPADIPDYYKQSFPEGFKWERVMNFEDGGAVTVTQDTSLEDGTLIHKVKLRGTNFPPDGPVMQRKTMGWEASTERLYPEDGVLKGDIKMALRLKDGGRYLADCKTTYKAKKPVQMPGAYNVDRKLDITSHNEDYTVVEQYERSEGRHSTGGMDELYK

Excerpts

No excerpts have been added for mWatermelon
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Biosensor Optimization Using a Förster Resonance Energy Transfer Pair Based on mScarlet Red Fluorescent Protein and an mScarlet-Derived Green Fluorescent Protein

Gohil K, Wu S-Y, Takahashi-Yamashiro K, Shen Y, Campbell Re

(2023). ACS Sensors, 8(2) , 587-597. doi: 10.1021/acssensors.2c01730. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change