compare

Comparison List

mVenus-Q69M

a.k.a. mVenus ME

mVenus-Q69M is a basic (constitutively fluorescent) yellow fluorescent protein published in 2010, derived from Aequorea victoria. It is reported to be a very rapidly-maturing monomer.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.9 kDa -

FPbase ID: FE6UX

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
515 528   96.97   9.6  

Photostability

No photostability measurements available ... add one!

mVenus-Q69M Sequence

mVenus-Q69M was derived from mVenus with the following mutations: Q69M
amino acid numbers relative to avGFP. show relative to mVenus

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLICTTGKLPVPWPTLVTTLGYGLMCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for mVenus-Q69M
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

A synthetic three-color scaffold for monitoring genetic regulation and noise

Cox R, Dunlop Mj, Elowitz Mb

(2010). Journal of Biological Engineering, 4(1) , 10. doi: 10.1186/1754-1611-4-10. Article   Pubmed

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change