compare

Comparison List

mUkG

a.k.a. mUmikinoko-Green, mUkG1

mUkG is a basic (constitutively fluorescent) green fluorescent protein published in 2008, derived from Sarcophyton sp.. It has moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Sarcophyton sp. 25.6 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
483 499 60,000 0.72 43.2 5.2    

Photostability

no photostability measurements available ... add one!

mUkG Sequence

MSVIKEEMKIKLHMEGNVNGHAFVIEGDGKGKPYDGTQTLNLTVKEGAPLPFSYDILTNAFQYGNRAFTKYPADIPDYFKQTFPEGYSWERTMSYEDNAICNVRSEISMEGDCFIYKIRFDGKNFPPNGPVMQKKTLKWEPSTEMMYVRDGFLMGDVNMALLLEGGGHHRCDFKTSYKAKKVVQLPDAHKIDHRIEILSHDRDYSKVKLYENAVARNSLLPSQA

Excerpts

No excerpts have been added for mUkG
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change