compare

Comparison List

muGFP

a.k.a. monomeric ultra-stable GFP

muGFP is a basic (constitutively fluorescent) green fluorescent protein published in 2018.
+
Aggregation Organism Molecular Weight Cofactor
Monomer <add one> 26.8 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
490 508 117,000 0.45 52.65      

Photostability

no photostability measurements available ... add one!

muGFP Sequence

MSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLTYGVLCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKAYFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEDVTAAGITHGMDELYK

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for muGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change