compare

Comparison List

mTurquoise2_T203Y

mTurquoise2_T203Y is a basic (constitutively fluorescent) cyan fluorescent protein published in 2025, derived from Aequorea victoria. It has low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.8 kDa -

FPbase ID: QPK3T

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
471 514 27,400 0.23 6.3 4.8   1.9
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mTurquoise2_T203Y Sequence

BLAST

mTurquoise2_T203Y was derived from mTurquoise2 with the following mutations: T203Y
amino acid numbers relative to avGFP. show relative to mTurquoise2

VSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSWGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYFSDNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for mTurquoise2_T203Y
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

A green lifetime biosensor for calcium that remains bright over its full dynamic range

Van Der Linden Fh, Thornquist Sc, Ter Beek Rm, Huijts Jy, Hink Ma, Gadella Twj, Maimon G, Goedhart J

(2025). , , . doi: 10.7554/elife.105086. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change