compare

Comparison List

mTFP0.3

mTFP0.3 is a basic (constitutively fluorescent) cyan fluorescent protein published in 2006, derived from Clavularia sp..

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Clavularia sp. 27.5 kDa -

FPbase ID: 8PKAY

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
458 488 19,000 0.31 5.89      

Photostability

No photostability measurements available ... add one!

mTFP0.3 Sequence

mTFP0.3 was derived from dTFP0.2 with the following mutations: S200K/S202K
amino acid numbers relative to cFP484. show relative to dTFP0.2

MVSKGEETTMGVIKPDMKIKLKMEGNVNGHAFVIEGEGEGKPYDGTNTVNLEVKEGAPLPFSYDILSNAFQYGNRAFTKYPDDIANYFKQSFPEGYSWERTMTFEDKGIVKVKSDISMEEDSFIYEIRLKGKNFPPNGPVMQKKTLKWEPSTEILYVRDGVLVGDIKHKLLLEGGGHYRCDFKTIYKAKKVVKLPDYHFVDHRIEILNHDKDYNKVTLYENAVARYSLLPPQAGMDELYK

Excerpts

No excerpts have been added for mTFP0.3
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change