compare

Comparison List

mTangerine

mTangerine is a basic (constitutively fluorescent) red fluorescent protein published in 2004, derived from Discosoma sp.. It has moderate acid sensitivity.
+
mTangerine Spectrum Fluorescent protein mTangerine excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 25.4 kDa -

FPbase ID: N63O3

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
568 585 38,000 0.3 11.4 5.7    

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
5.1   Shaner et al. (2004)

mTangerine Sequence

mTangerine was derived from mRFP1.1 with the following mutations: M66C/Q213L

MASSEDVIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFCYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKMRLKLKDGGHYDAEVKTTYMAKKPVQLPGAYKTDIKLDITSHNEDYTIVELYERAEGRHSTGA
GenBank: AAV52170
IPG: 3838142

Excerpts

No excerpts have been added for mTangerine
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change