compare

Comparison List

mRojoB

mRojoB is a basic (constitutively fluorescent) red fluorescent protein published in 2010, derived from Discosoma sp.. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.8 kDa -

FPbase ID: 6LJKY

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
598 631 61,000 0.06 3.66 5.0    

Photostability

No photostability measurements available ... add one!

mRojoB Sequence

mRojoB was derived from mCherry with the following mutations: V16T/Q163M/V195A/I197Y/A217C
amino acid numbers relative to DsRed. show relative to mCherry

MVSKGEEDNMAIIKEFMRFKTHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKMRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNANYKLDITSHNEDYTIVEQYERCEGRHSTGGMDELYK

Excerpts

No excerpts have been added for mRojoB
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Generation of longer emission wavelength red fluorescent proteins using computationally designed libraries

Chica Ra, Moore Mm, Allen Bd, Mayo Sl

(2010). Proceedings of the National Academy of Sciences, 107(47) , 20257-20262. doi: 10.1073/pnas.1013910107. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change