compare

Comparison List

mRojoA

mRojoA is a basic (constitutively fluorescent) red fluorescent protein published in 2010, derived from Discosoma sp.. It has moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.7 kDa -

FPbase ID: QEO8D

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
597 633 48,000 0.02 0.96 5.4    

Photostability

No photostability measurements available ... add one!

mRojoA Sequence

mRojoA was derived from mCherry with the following mutations: V16T/R125H/Q163L/V195A/I197Y/A217C
amino acid numbers relative to DsRed. show relative to mCherry

MVSKGEEDNMAIIKEFMRFKTHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLHGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKLRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNANYKLDITSHNEDYTIVEQYERCEGRHSTGGMDELYK

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for mRojoA
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Generation of longer emission wavelength red fluorescent proteins using computationally designed libraries

Chica Ra, Moore Mm, Allen Bd, Mayo Sl

(2010). Proceedings of the National Academy of Sciences, 107(47) , 20257-20262. doi: 10.1073/pnas.1013910107. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change