compare

Comparison List

moxGFP

similar: oxGFP

moxGFP is a basic (constitutively fluorescent) green fluorescent protein published in 2015, derived from Aequorea victoria. It is reported to be a rapidly-maturing monomer.
+
moxGFP Spectrum Fluorescent protein moxGFP excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.9 kDa -

FPbase ID: H99SX

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
486 510 87,000 0.58 50.46   17.1  

Photostability

No photostability measurements available ... add one!

moxGFP Sequence

moxGFP was derived from oxGFP with the following mutations: V206K
amino acid numbers relative to avGFP. show relative to oxGFP

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFISTTGKLPVPWPTLVTTLTYGVQSFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for moxGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change