compare

Comparison List

moxCerulean3

moxCerulean3 is a basic (constitutively fluorescent) cyan fluorescent protein published in 2015, derived from Aequorea victoria.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.6 kDa -

FPbase ID: TPB93

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
434 474 41,000 0.87 35.67   100.4  

Photostability

No photostability measurements available ... add one!

moxCerulean3 Sequence

moxCerulean3 was derived from mCerulean3 with the following mutations: S30R/Y39N/C48S/C70S/N105T/I171V
amino acid numbers relative to avGFP. show relative to mCerulean3

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFISTTGKLPVPWPTLVTTLSWGVQSFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNAIHGNVYITADKQKNGIKANFGLNCNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for moxCerulean3
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change