compare

Comparison List

mNeptune2.5

mNeptune2.5 is a basic (constitutively fluorescent) red fluorescent protein published in 2014, derived from Entacmaea quadricolor. It is reported to be a rapidly-maturing monomer with moderate acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 27.5 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
599 643 95,000 0.24 22.8 5.8 26.0  

Photostability

no photostability measurements available ... add one!

mNeptune2.5 Sequence

mNeptune2.5 was derived from mNeptune2 with the following mutations: M11T/S28H/G41N
amino acid numbers relative to eqFP578. show relative to mNeptune2

MVSKGEELIKENMHTKLYMEGTVNNHHFKCTHEGEGKPYEGTQTNRIKVVEGGPLPFAFDILATCFMYGSKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTVTQDTSLQDGCLIYNVKLRGVNFPSNGPVMQKKTLGWEASTETLYPADGGLEGRCDMALKLVGGGHLHCNLKTTYRSKKPAKNLKMPGVYFVDRRLERIKEADNETYVEQHEVAVARYCDLPSKLGHKLNGMDELYK
GenBank: AHL19969
IPG: 49083569

Excerpts

No excerpts have been added for mNeptune2.5
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change