compare

Comparison List

MmGFP6

a.k.a. MmGFP

MmGFP6 is a basic (constitutively fluorescent) fluorescent protein published in 1997, derived from Aequorea victoria. It is reported to be a dimer.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
Dimer Aequorea victoria 26.9 kDa -

FPbase ID: CQ6UF

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

MmGFP6 Sequence

MmGFP6 was derived from mGFP5 with the following mutations: H25Y/F64L/S65T/G191D

MSKGEELFTGVVPILVELDGDVNGYKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKANFKTRHNIEDGGVQLADHYQQNTPIGDDPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

We based MmGFP on mGFP5 (Siemering et al., 1996), which has two mutations, V163A and S175G, that improve the folding of the apoprotein and, therefore, its solubility, at higher temperatures. There are also codon usage changes that remove a cryptic splice site recognised in plants (Haseloff and Amos, 1995). Two further mutations, F64L and S65T, were introduced by PCR mutagenesis. The S65T mutation enhances the blue light absorption of GFP (Heim et al., 1995) and the F64L mutation (Cormack et al., 1996) enhances its solubility in bacterial cells, and therefore may also improve apoprotein folding in mammalian cells. (MmGFP also contains two apparently silent mutations, H25Y and G191D, that do not measurably affect fluorescence intensity.) MmGFP matures well at 37°C and is easily detectable in living mammalian cells using a standard FITC filter set.

Zernicka-Goetz et al. (1997)

Primary Reference

Following cell fate in the living mouse embryo

Zernicka-Goetz M, Pines J, Hunter Sml, Dixon Jpc, Siemering Kr, Haseloff J, Evans Mj

(1997). Development, 124(6) , 1133-1137. doi: 10.1242/dev.124.6.1133. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change