compare

Comparison List

mGFP5

mGFP5 is a basic (constitutively fluorescent) fluorescent protein published in 1996, derived from Aequorea victoria. Note that the "m" in mGFP does not refer to "monomeric", but rather is derived from the gene name.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
Dimer Aequorea victoria 26.8 kDa -

FPbase ID: 9GPZ6

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

mGFP5 Sequence

BLAST

mGFP5 was derived from avGFP with the following mutations: V163A/I167T/S175G

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKANFKTRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for mGFP5
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Mutations that suppress the thermosensitivity of green fluorescent protein

Siemering Kr, Golbik R, Sever R, Haseloff J

(1996). Current Biology, 6(12) , 1653-1663. doi: 10.1016/s0960-9822(02)70789-6. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change