compare

Comparison List

mMaroon1

mMaroon1 is a basic (constitutively fluorescent) far red fluorescent protein published in 2016, derived from Entacmaea quadricolor. It is reported to be a rapidly-maturing monomer with high acid sensitivity.
+
mMaroon1 Spectrum Fluorescent protein mMaroon1 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 27.6 kDa -

FPbase ID: RATTD

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
609 657 80,000 0.11 8.8 6.2 20.0  

mMaroon1 OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
46.3 ± 6.3 (150 cells) - - Bajar et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
178.0   Bajar et al. (2016)

mMaroon1 Sequence

mMaroon1 was derived from Maroon0.1 with the following mutations: M11T/M15L/E16T/H23Y/K25E/S28A/G41N/E47R/T73P/Q74P/G75D/F79Y/V93T/T95V/V101T/V104A/K120Q/L121V/V124E/G153S/C158L/N173R/K175E/V195I
amino acid numbers relative to eqFP578. show relative to Maroon0.1

MVSKGEELIKENMHTKLYLTGTVNNHYFECTAEGEGKPYEGTQTNRIKVVRGGPLPFAFDILAPCFMYGSKTFINHPPDIPDYFKQSFPEGFTWERTTVYEDGGTLTATQDTSLQDGCLIYNVQVRGENFPSNGPVMQKKTLGWEASTETLYPADGSLEGRLDWALKLVGGGHLHCRLETTYRSKKPAKNLKMPGVYFIDRRLERIKEADNETYVEQHEVAVARYCDLPSKLGHKLNGMDELYK
GenBank: AOY07814

Excerpts

No excerpts have been added for mMaroon1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change