compare

Comparison List

Maroon0.1

Maroon0.1 is a basic (constitutively fluorescent) far red fluorescent protein published in 2016, derived from Entacmaea quadricolor. It was an intermediate protein in the evolution of mMaroon1 from mNeptune2
+
Oligomerization Organism Molecular Weight Cofactor
Dimer Entacmaea quadricolor 27.5 kDa -

FPbase ID: 6F9A8

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
610 650 50,000 0.11 5.5      

Photostability

No photostability measurements available ... add one!

Maroon0.1 Sequence

Maroon0.1 was derived from mNeptune2 with the following mutations: T60P/M160W
amino acid numbers relative to eqFP578. show relative to mNeptune2

MVSKGEELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTGRIKVVEGGPLPFAFDILAPCFMYGSKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTVTQDTSLQDGCLIYNVKLRGVNFPSNGPVMQKKTLGWEASTETLYPADGGLEGRCDWALKLVGGGHLHCNLKTTYRSKKPAKNLKMPGVYFVDRRLERIKEADNETYVEQHEVAVARYCDLPSKLGHKLNGMDELYK

Excerpts

No excerpts have been added for Maroon0.1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change