compare

Comparison List

mLemon

a.k.a. mLem

mLemon is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2024, derived from Aequorea victoria. It is reported to be a very rapidly-maturing monomer with low acid sensitivity.
+
mLemon Spectrum Fluorescent protein mLemon excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.7 kDa -

FPbase ID: Q7WVB

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
514 526 125,000 0.74 92.5 4.8 12.0  

Photostability

No photostability measurements available ... add one!

mLemon Sequence

mLemon was derived from mChartreuse with the following mutations: T63S/T65G/S72A/T203Y/V224L

MSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATIGKLTLKFICTTGKLPVPWPTLVTSLGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGSGFKEDGNILGHKLEYNYNSHKVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSKLSKDPNEKRDHMVLLEFLTAAGITHGMDELYK

Excerpts

No excerpts have been added for mLemon
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change