compare

Comparison List

mChartreuse

a.k.a. mCha

mChartreuse is a basic (constitutively fluorescent) green fluorescent protein published in 2024, derived from Aequorea victoria. It is reported to be a very rapidly-maturing monomer with low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.7 kDa -

FPbase ID: J59TV

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
487 510 71,000 0.75 53.25 4.9 4.9  

Photostability

No photostability measurements available ... add one!

mChartreuse Sequence

mChartreuse was derived from Superfolder GFP with the following mutations: N39I/R80Q/I128S/D129G/F145Y/N149K/V206K

Note: As noted in the supplementary methods of the primary reference, this sequence contains R80Q relative to the "official" sequence for sfGFP, as that mutation was indeed present in the sfGFP templated used by the authors. However, like many derivatives of GFP, the Q/R mutation at 80 is considered inconsequential and does not represent an intentional mutation for mChartreuse.

MSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATIGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGSGFKEDGNILGHKLEYNYNSHKVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for mChartreuse
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change